PDB entry 1qb5

View 1qb5 on RCSB PDB site
Description: escherichia coli heat labile enterotoxin type iib b-pentamer
Class: enterotoxin
Keywords: enterotoxin
Deposited on 1999-04-30, released 2003-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.06: d1qb5d_
• Chain 'E':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.06: d1qb5e_
• Chain 'F':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.06: d1qb5f_
• Chain 'G':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.06: d1qb5g_
• Chain 'H':
  Compound: protein (heat labile enterotoxin type iib b-pentamer)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.06: d1qb5h_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qb5D (D:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qb5E (E:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qb5F (F:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qb5G (G:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qb5H (H:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae