PDB entry 1qb4

View 1qb4 on RCSB PDB site
Description: crystal structure of mn(2+)-bound phosphoenolpyruvate carboxylase
Deposited on 1999-04-30, released 2002-05-01
The last revision prior to the SCOP 1.71 freeze date was dated 2002-05-01, with a file datestamp of 2002-05-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1qb4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qb4A (A:)
    mneqysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttl
    qnlsndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsed
    tikkaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrq
    liaqswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvef
    vpvrftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpell
    alvgeegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacy
    qslqacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyes
    wseadkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktp
    sdvlavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmig
    ysdsakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqp
    pgslkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdel
    sviscdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpakrrptggveslraipwifa
    wtqnrlmlpawlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlae
    yydqrlvdkalwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdpln
    vlqaellhrsrqaekegqepdprveqalmvtiagiaagmrntg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qb4A (A:)
    qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
    sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
    kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
    qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
    rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
    geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
    qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
    adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
    lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
    sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
    lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
    scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpakveslraipwifawtqnrlmlp
    awlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyydqrlvdk
    alwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlqaellhr
    srqaekegqepdprveqalmvtiagiaagmrntg