PDB entry 1qb2

View 1qb2 on RCSB PDB site
Description: crystal structure of the conserved subdomain of human protein srp54m at 2.1a resolution: evidence for the mechanism of signal peptide binding
Class: signaling protein
Keywords: alpha-helix, helix-turn-helix, signaling protein
Deposited on 1999-04-29, released 1999-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human signal recognition particle 54 kd protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qb2a_
  • Chain 'B':
    Compound: human signal recognition particle 54 kd protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qb2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qb2A (A:)
    qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
    eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qb2A (A:)
    qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
    eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qb2B (B:)
    qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
    eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkm