PDB entry 1qb1

View 1qb1 on RCSB PDB site
Description: bovine trypsin with 1-[2-[5-[amino(imino)methyl]-2-hydroxyphenoxy]-6- [3-(4,5-dihydro-1-methyl-1h-imidazol-2-yl)phenoxy]pyridin-4- yl]piperidine-3-carboxylic acid (zk-806974)
Deposited on 1999-04-28, released 2000-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-29, with a file datestamp of 2000-04-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qb1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qb1A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn