PDB entry 1qay

View 1qay on RCSB PDB site
Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with mevalonate and nad+
Deposited on 1999-04-07, released 1999-06-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-18, with a file datestamp of 1999-06-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qayA (A:)
    dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
    vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiqd
    plnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvrd
    amgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsgea
    viegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghygs
    lttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgla
    qnlgamralategiqrghmalhar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qayB (B:)
    dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
    vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiqd
    plnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvrd
    amgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsgea
    viegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghygs
    lttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgla
    qnlgamralategi