PDB entry 1qax

View 1qax on RCSB PDB site
Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with hmg-coa and nad+
Class: oxidoreductase
Keywords: 4-electron oxido-reductase, oxidoreductase
Deposited on 1999-04-06, released 1999-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (3-hydroxy-3-methylglutaryl-coenzyme a reductase)
    Species: Pseudomonas mevalonii [TaxId:32044]
    Gene: MVAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qaxa1, d1qaxa2
  • Chain 'B':
    Compound: protein (3-hydroxy-3-methylglutaryl-coenzyme a reductase)
    Species: Pseudomonas mevalonii [TaxId:32044]
    Gene: MVAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qaxb1, d1qaxb2
  • Heterogens: HMG, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qaxA (A:)
    msldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfel
    pyavasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivg
    iqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivd
    vrdamgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefs
    geaviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsgh
    ygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavav
    glaqnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradrava
    llkqkrgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qaxA (A:)
    dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
    vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiqd
    plnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvrd
    amgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsgea
    viegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghygs
    lttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgla
    qnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradravallk
    qkrgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qaxB (B:)
    msldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfel
    pyavasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivg
    iqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivd
    vrdamgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefs
    geaviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsgh
    ygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavav
    glaqnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradrava
    llkqkrgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qaxB (B:)
    dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
    vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiqd
    plnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvrd
    amgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsgea
    viegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghygs
    lttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgla
    qnlgamralate