PDB entry 1qaw

View 1qaw on RCSB PDB site
Description: Regulatory Features of the TRP Operon and the Crystal Structure of the TRP RNA-Binding Attenuation Protein from Bacillus Stearothermophilus.
Class: RNA-binding protein
Keywords: circular assembly, 11-fold symmetry, RNA-binding protein
Deposited on 1999-03-31, released 1999-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawa_
  • Chain 'B':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawb_
  • Chain 'C':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawc_
  • Chain 'D':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawd_
  • Chain 'E':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawe_
  • Chain 'F':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawf_
  • Chain 'G':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawg_
  • Chain 'H':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawh_
  • Chain 'I':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawi_
  • Chain 'J':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawj_
  • Chain 'K':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qawk_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qawA (A:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawA (A:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviese
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qawB (B:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawB (B:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qawC (C:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawC (C:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qawD (D:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawD (D:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qawE (E:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawE (E:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qawF (F:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawF (F:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qawG (G:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawG (G:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviese
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qawH (H:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawH (H:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1qawI (I:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawI (I:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviese
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1qawJ (J:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawJ (J:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviese
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1qawK (K:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qawK (K:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg