PDB entry 1qas

View 1qas on RCSB PDB site
Description: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1
Deposited on 1996-08-02, released 1997-02-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qasA (A:)
    ykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslieryepseta
    kaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledqltgps
    steayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspyp
    vilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklgg
    llpaggengseatdvsdeveaaemedeavrsqvqhkpkedklklvpelsdmiiycksvhf
    ggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriypagwrtdssnysp
    vemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgp
    wwrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnngfnprw
    dmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhllskngdqhp
    satlfvkisiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qasA (A:)
    ykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslieryepseta
    kaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledqltgps
    steayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspyp
    vilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklgg
    klvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsc
    lsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpa
    flrdpnttfnsraltqgpwwrperlrvriisgqqlpkvnivdpkviveihgvgrdtgsrq
    tavitnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyr
    hvhllskngdqhpsatlfvkisiqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qasB (B:)
    kmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslieryepsetak
    aqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledqltgpss
    teayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspypv
    ilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklggl
    lpaggengseatdvsdeveaaemedeavrsqvqhkpkedklklvpelsdmiiycksvhfg
    gfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriypagwrtdssnyspv
    emwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpw
    wrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnngfnprwd
    mefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhllskngdqhps
    atlfvkisiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qasB (B:)
    kmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslieryepsetak
    aqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledqltgpss
    teayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspypv
    ilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklggl
    klklvpelsdmiiycksvhfggfsspgqafyemasfsesralrllqesgngfvrhnvscl
    sriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaf
    lrdpnttfnsraltqgpwwrperlrvriisgqqlpkvnivdpkviveihgvgrdtgsrqt
    avitnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrh
    vhllskngdqhpsatlfvkisiqd