PDB entry 1qaq

View 1qaq on RCSB PDB site
Description: the structure of the rrna methyltransferase ermc': implications for the reaction mechanism
Deposited on 1999-03-28, released 2000-03-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qaqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qaqA (A:)
    sqnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaieidhklcktt
    enklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsiadeiylive
    ygfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkksrishkdk
    qkynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk