PDB entry 1qak

View 1qak on RCSB PDB site
Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
Deposited on 1999-03-15, released 1999-08-24
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-24, with a file datestamp of 1999-08-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qakA (A:)
    hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
    nkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrfte
    isllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahg
    mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
    isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkp
    mqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggm
    ivpygdpdigwyfkaylasgdygmgtltspiargkdapsnavllnetiadytgvpmeipr
    aiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengtigidag
    atgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslva
    mdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqi
    ipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglg
    qyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qakB (B:)
    hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
    nkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrfte
    isllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahg
    mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
    isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkp
    mqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggm
    ivpygdpdigwyfkaylasgdygmgtltspiargkdapsnavllnetiadytgvpmeipr
    aiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengtigidag
    atgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslva
    mdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqi
    ipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglg
    qyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk
    dk