PDB entry 1qah

View 1qah on RCSB PDB site
Description: crystal structure of perchloric acid soluble protein-a translational inhibitor
Class: alpha-beta structure
Keywords: alpha-beta structure
Deposited on 1999-03-12, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: perchloric acid soluble protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qaha_
  • Chain 'B':
    Compound: perchloric acid soluble protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qahb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qahA (A:)
    ssiirkvistskapaaigaysqavlvdrtiyvsgqigmdpssgqlvpggvaeeakqalkn
    lgeilkaagcdftnvvkttvlladindfgtvneiyktyfqgnlparaayqvaalpkgsri
    eieaiavqgpfttagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qahA (A:)
    ssiirkvistskapaaigaysqavlvdrtiyvsgqigmdpssgqlvpggvaeeakqalkn
    lgeilkaagcdftnvvkttvlladindfgtvneiyktyfqgnlparaayqvaalpkgsri
    eieaiavqgpft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qahB (B:)
    ssiirkvistskapaaigaysqavlvdrtiyvsgqigmdpssgqlvpggvaeeakqalkn
    lgeilkaagcdftnvvkttvlladindfgtvneiyktyfqgnlparaayqvaalpkgsri
    eieaiavqgpfttagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qahB (B:)
    ssiirkvistskapaaigaysqavlvdrtiyvsgqigmdpssgqlvpggvaeeakqalkn
    lgeilkaagcdftnvvkttvlladindfgtvneiyktyfqgnlparaayqvaalpkgsri
    eieaiavqgpft