PDB entry 1qac

View 1qac on RCSB PDB site
Description: change in dimerization mode by removal of a single unsatisfied polar residue
Class: immune system
Keywords: beta barrel immunoglobulin vl domain dimer, flipped domain dimer, immune system
Deposited on 1999-02-25, released 2000-02-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin light chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QAC
    Domains in SCOPe 2.05: d1qaca_
  • Chain 'B':
    Compound: immunoglobulin light chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QAC (0-113)
    Domains in SCOPe 2.05: d1qacb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qacA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyyclqyystpysfgqgtkleikr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qacB (B:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyyclqyystpysfgqgtkleikr