PDB entry 1qac

View 1qac on RCSB PDB site
Description: change in dimerization mode by removal of a single unsatisfied polar residue
Class: immune system
Keywords: beta barrel immunoglobulin vl domain dimer, flipped domain dimer
Deposited on 1999-02-25, released 2000-02-23
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin light chain variable domain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1qaca_
  • Chain 'B':
    Compound: immunoglobulin light chain variable domain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1qacb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qacA (A:)
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyyclqyystpysfgqgtkleikr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qacB (B:)
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyyclqyystpysfgqgtkleikr