PDB entry 1qab

View 1qab on RCSB PDB site
Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP
Class: transport protein
Keywords: human serum retinol binding protein, transthyretin, prealbumin, TRANSPORT PROTEIN
Deposited on 1999-02-03, released 1999-02-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.278
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transthyretin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qaba_
  • Chain 'B':
    Compound: protein (transthyretin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qabb_
  • Chain 'C':
    Compound: protein (transthyretin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qabc_
  • Chain 'D':
    Compound: protein (transthyretin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qabd_
  • Chain 'E':
    Compound: PROTEIN (retinol binding protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qabe_
  • Chain 'F':
    Compound: PROTEIN (retinol binding protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qabf_
  • Heterogens: RTL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qabA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qabA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qabB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qabB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qabC (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qabC (C:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qabD (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qabD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qabE (E:)
    cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl
    lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll
    nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngycdgrsernll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qabF (F:)
    cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl
    lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll
    nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngycdgrsernll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qabF (F:)
    cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl
    lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll
    nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngyc