PDB entry 1qa9

View 1qa9 on RCSB PDB site
Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors
Class: immune system
Keywords: cell adhesion, ig-like domain, cd2, cd58, immune system
Deposited on 1999-04-13, released 1999-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.223
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human cd2 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QA9 (0-101)
    Domains in SCOPe 2.07: d1qa9a_
  • Chain 'B':
    Compound: human cd58 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QA9 (0-94)
    Domains in SCOPe 2.07: d1qa9b_
  • Chain 'C':
    Compound: human cd2 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QA9 (0-101)
    Domains in SCOPe 2.07: d1qa9c_
  • Chain 'D':
    Compound: human cd58 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QA9 (0-94)
    Domains in SCOPe 2.07: d1qa9d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qa9A (A:)
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell
kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qa9B (B:)
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qa9C (C:)
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell
kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qa9D (D:)
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges