PDB entry 1qa7

View 1qa7 on RCSB PDB site
Description: crystal complex of the 3c proteinase from hepatitis a virus with its inhibitor and implications for the polyprotein processing in hav
Deposited on 1999-04-15, released 1999-04-19
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-15, with a file datestamp of 2000-05-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1qa7a_
  • Chain 'B':
    Domains in SCOP 1.57: d1qa7b_
  • Chain 'C':
    Domains in SCOP 1.57: d1qa7c_
  • Chain 'D':
    Domains in SCOP 1.57: d1qa7d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa7A (A:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa7B (B:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnidkkie
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa7C (C:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnid
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa7D (D:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnidkkie