PDB entry 1q9w

View 1q9w on RCSB PDB site
Description: S45-18 Fab pentasaccharide bisphosphate complex
Deposited on 2003-08-26, released 2004-01-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9wA (A:)
    divmsqfpsslavsagekvtmsckssqsllnsrtrksylawyqqkpgqfpklliywaatr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9wB (B:)
    evilvesggglvqpggslrlscstsgftftdyymswvrqppgkalewlgfirnkpkgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycvrdiysfgsrdgmdywgqgtsv
    tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
    lqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9wC (C:)
    divmsqfpsslavsagekvtmsckssqsllnsrtrksylawyqqkpgqfpklliywaatr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9wD (D:)
    evilvesggglvqpggslrlscstsgftftdyymswvrqppgkalewlgfirnkpkgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycvrdiysfgsrdgmdywgqgtsv
    tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
    lqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc