PDB entry 1q9u

View 1q9u on RCSB PDB site
Description: Crystal structure of uncharacterized conserved protein DUF302 from Bacillus stearothermophilus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Zn-binding proteins, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-08-25, released 2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein APC35924
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: APC35924
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9U (Start-129)
    Domains in SCOPe 2.08: d1q9ua_
  • Chain 'B':
    Compound: Uncharacterized protein APC35924
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: APC35924
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9U (Start-129)
    Domains in SCOPe 2.08: d1q9ub_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q9uA (A:)
    snamfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevc
    npqeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiek
    rlaacldrcr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9uA (A:)
    amfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevcnp
    qeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiekrl
    aacldrcr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q9uB (B:)
    snamfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevc
    npqeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiek
    rlaacldrcr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9uB (B:)
    amfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevcnp
    qeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiekrl
    aacldrcr