PDB entry 1q9s

View 1q9s on RCSB PDB site
Description: Crystal structure of riboflavin kinase with ternary product complex
Deposited on 2003-08-25, released 2003-12-16
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.199
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1q9sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9sA (A:)
    imrhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvh
    kmvvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisai
    qgdieeakkrlelpeylkikednffqvsk