PDB entry 1q9r

View 1q9r on RCSB PDB site
Description: S25-2- a(2-8)Kdo disaccharide complex
Deposited on 2003-08-25, released 2004-01-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.203
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9rA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9rB (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr