PDB entry 1q9p

View 1q9p on RCSB PDB site
Description: Solution structure of the mature HIV-1 protease monomer
Class: hydrolase
Keywords: HIV-1 protease, HYDROLASE
Deposited on 2003-08-25, released 2004-03-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2008-03-11, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Homo sapiens [TaxId:9606]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-94)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.03: d1q9pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9pA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqiga