PDB entry 1q9l

View 1q9l on RCSB PDB site
Description: S25-2 Fab Unliganded 2
Class: immune system
Keywords: antigen-binding fragment, Fab, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, IMMUNE SYSTEM
Deposited on 2003-08-25, released 2004-01-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S25-2 Fab (IgG1k) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9L (0-218)
    Domains in SCOPe 2.05: d1q9la1, d1q9la2
  • Chain 'B':
    Compound: S25-2 Fab (IgG1k) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9L (0-221)
    Domains in SCOPe 2.05: d1q9lb1, d1q9lb2
  • Chain 'C':
    Compound: S25-2 Fab (IgG1k) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9L (0-218)
    Domains in SCOPe 2.05: d1q9lc1, d1q9lc2
  • Chain 'D':
    Compound: S25-2 Fab (IgG1k) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9L (0-221)
    Domains in SCOPe 2.05: d1q9ld1, d1q9ld2
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9lA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9lB (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9lC (C:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9lD (D:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr