PDB entry 1q9j

View 1q9j on RCSB PDB site
Description: Structure of polyketide synthase associated protein 5 from Mycobacterium tuberculosis
Deposited on 2003-08-25, released 2004-05-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q9jA (A:)
    mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqs
    sdggwnlvaddllhsgicvidgtaatngspsgnaelrldqsvsllhlqlilreggaeltl
    ylhhcmadghhgavlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirkqglsg
    aerfmsvmyayeipatetpavlahpglpqavpvtrlwlskqqtsdlmafgrehrlslnav
    vaaailltewqlrntphvpipyvypvdlrfvlappvapteatnllgaasylaeigpntdi
    vdlasdivatlradlangviqqsglhfgtafegtppglpplvfctdatsfptmrtppgle
    iedikgqfycsisvpldlyscavyagqliiehhghiaepgksleairsllctvpseygwi
    me
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9jA (A:)
    mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqs
    sdggwnlvaddllhsgicvidaelrldqsvsllhlqlilreggaeltlylhhcmadghhg
    avlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirkaerfmsvmyaypglpqa
    vpvtrlwlskqqtsdlmafgrehrlslnavvaaailltewqlrntphvpipyvypvdlrf
    vlappvapteatnllgaasylaeigpntdivdlasdivatlradlangviqqsglhfgta
    fegtppglpplvfctdatsfptmrtppgleiedikgqfycsisvpldlyscavyagqlii
    ehhghiaepgksleairsllctvpseyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q9jB (B:)
    mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqs
    sdggwnlvaddllhsgicvidgtaatngspsgnaelrldqsvsllhlqlilreggaeltl
    ylhhcmadghhgavlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirkqglsg
    aerfmsvmyayeipatetpavlahpglpqavpvtrlwlskqqtsdlmafgrehrlslnav
    vaaailltewqlrntphvpipyvypvdlrfvlappvapteatnllgaasylaeigpntdi
    vdlasdivatlradlangviqqsglhfgtafegtppglpplvfctdatsfptmrtppgle
    iedikgqfycsisvpldlyscavyagqliiehhghiaepgksleairsllctvpseygwi
    me
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9jB (B:)
    pgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqssd
    ggwnlvaddllhsgicvidaelrldqsvsllhlqlilreggaeltlylhhcmadghhgav
    lvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirkaerfmsvmyayeipatetp
    avlahpglpqavpvtrlwlskqqtsdlmafgrehrlslnavvaaailltewqlrntphvp
    ipyvypvdlrfvlappvapteatnllgaasylaeigpntdivdlasdivatlradlangv
    iqqsglhfgtafegtppglpplvfctdatsfptmrtppgleiedikgqfycsisvpldly
    scavyagqliiehhghiaepgksleairsllctvpseyg