PDB entry 1q9h

View 1q9h on RCSB PDB site
Description: 3-Dimensional structure of native Cel7A from Talaromyces emersonii
Class: hydrolase
Keywords: cellobiohydrolase I catalytic domain, HYDROLASE
Deposited on 2003-08-25, released 2004-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3499999999999996 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellobiohydrolase I catalytic domain
    Species: Talaromyces emersonii [TaxId:68825]
    Database cross-references and differences (RAF-indexed):
    • GB AAL89553 (0-End)
    Domains in SCOPe 2.08: d1q9ha_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q9hA (A:)
    eqagtataenhppltwqectapgscttqngavvldanwrwvhdvngytncytgntwdpty
    cpddetcaqncaldgadyegtygvtssgsslklnfvtgsnvgsrlyllqddstyqifkll
    nrefsfdvdvsnlpcglngalyfvamdadggvskypnnkagakygtgycdsqcprdlkfi
    dgeanvegwqpssnnantgigdhgsccaemdvweansisnavtphpcdtpgqtmcsgddc
    ggtysndryagtcdpdgcdfnpyrmgntsfygpgkiidttkpftvvtqfltddgtdtgtl
    seikrfyiqnsnvipqpnsdisgvtgnsittefctaqkqafgdtddfsqhgglakmgaam
    qqgmvlvmslwddyaaqmlwldsdyptdadpttpgiargtcptdsgvpsdvesqspnsyv
    tysnikfgpinstftas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9hA (A:)
    eqagtataenhppltwqectapgscttqngavvldanwrwvhdvngytncytgntwdpty
    cpddetcaqncaldgadyegtygvtssgsslklnfvtgsnvgsrlyllqddstyqifkll
    nrefsfdvdvsnlpcglngalyfvamdadggvskypnnkagakygtgycdsqcprdlkfi
    dgeanvegwqpstgigdhgsccaemdvweansisnavtphpcdtpgqtmcsgddcggtys
    ndryagtcdpdgcdfnpyrmgntsfygpgkiidttkpftvvtqfltddgtdtgtlseikr
    fyiqnsnvipqpnsdisgvtgnsittefctaqkqafgdtddfsqhgglakmgaamqqgmv
    lvmslwddyaaqmlwldsdyptdadpttpgiargtcptdsgvpsdvesqspnsyvtysni
    kfgpinstft