PDB entry 1q9e

View 1q9e on RCSB PDB site
Description: RNase T1 variant with adenine specificity
Class: hydrolase
Keywords: Ribonuclease, Hydrolase, Adenine specificity
Deposited on 2003-08-25, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Guanyl-specific ribonuclease T1 precursor
  Species: Aspergillus oryzae [TaxId:5062]
  Gene: RNTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • engineered (40-42)
    • engineered (44-45)
  Domains in SCOPe 2.08: d1q9ea_
• Chain 'B':
  Compound: Guanyl-specific ribonuclease T1 precursor
  Species: Aspergillus oryzae [TaxId:5062]
  Gene: RNTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • engineered (40-42)
    • engineered (44-45)
  Domains in SCOPe 2.08: d1q9eb_
• Chain 'C':
  Compound: Guanyl-specific ribonuclease T1 precursor
  Species: Aspergillus oryzae [TaxId:5062]
  Gene: RNTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • engineered (40-42)
    • engineered (44-45)
  Domains in SCOPe 2.08: d1q9ec_
• Heterogens: TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q9eA (A:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwngfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q9eB (B:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwngfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q9eC (C:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwngfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect