PDB entry 1q9c

View 1q9c on RCSB PDB site
Description: Crystal Structure of the Histone domain of Son of Sevenless
Deposited on 2003-08-24, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: 0.255
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q9ca_
  • Chain 'B':
    Domains in SCOP 1.67: d1q9cb_
  • Chain 'C':
    Domains in SCOP 1.67: d1q9cc_
  • Chain 'D':
    Domains in SCOP 1.67: d1q9cd_
  • Chain 'E':
    Domains in SCOP 1.67: d1q9ce_
  • Chain 'F':
    Domains in SCOP 1.67: d1q9cf_
  • Chain 'G':
    Domains in SCOP 1.67: d1q9cg_
  • Chain 'H':
    Domains in SCOP 1.67: d1q9ch_
  • Chain 'I':
    Domains in SCOP 1.67: d1q9ci_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q9cA (A:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cA (A:)
    lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
    sasdveervqksfphpidkwaiadaqsaieslpvekihpllkevlgykidhqvsvyivav
    leyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q9cB (B:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cB (B:)
    pyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqprs
    asdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhqv
    svyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q9cC (C:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cC (C:)
    ffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqprsasd
    veervqksfphpidkwaiadaqsaieplslpvekihpllkevlgykidhqvsvyivavle
    yisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q9cD (D:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cD (D:)
    lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
    sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
    vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1q9cE (E:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cE (E:)
    lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
    sasdveervqksfphpidkwaiadaqsaiekrrnplslpvekihpllkevlgykidhqvs
    vyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1q9cF (F:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cF (F:)
    lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
    sasdveervqksfphpidkwaiadaqsaiekrplslpvekihpllkevlgykidhqvsvy
    ivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q9cG (G:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cG (G:)
    lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
    sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
    vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q9cH (H:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cH (H:)
    lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
    sasdveervqksfphpidkwaiadaqsaiekrkrlslpvekihpllkevlgykidhqvsv
    yivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1q9cI (I:)
    mqaqqlpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlc
    qaqprsasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgy
    kidhqvsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdv
    edinilsltde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9cI (I:)
    lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
    sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
    vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi