PDB entry 1q99

View 1q99 on RCSB PDB site
Description: Crystal structure of the Saccharomyces cerevisiae SR protein kinsae, Sky1p, complexed with the non-hydrolyzable ATP analogue, AMP-PNP
Class: transferase
Keywords: protein kinase
Deposited on 2003-08-22, released 2003-09-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.22
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SR protein kinsae
    Species: Saccharomyces cerevisiae
    Gene: SKY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03656 (Start-166)
      • see remark 999 (167-168)
    • Uniprot Q03656 (169-End)
    Domains in SCOP 1.75: d1q99a_
  • Chain 'B':
    Compound: SR protein kinsae
    Species: Saccharomyces cerevisiae
    Gene: SKY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03656 (Start-166)
      • see remark 999 (167-168)
    • Uniprot Q03656 (169-End)
    Domains in SCOP 1.75: d1q99b_
  • Heterogens: NI, SO4, ANP, EDO, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q99A (A:)
    dyrpggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyte
    aaedeikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllali
    kkyehrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikia
    dlgnacwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeg
    hsytkdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvlteky
    kfskdeakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdi
    pgwfeevrdhkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q99A (A:)
    gyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaede
    ikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyeh
    rgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgna
    cwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfetkdddhiaq
    iiellgelpsyllrngkytrtffnsllrnisklkfwpledvltekykfskdeakeisdfl
    spmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q99B (B:)
    dyrpggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyte
    aaedeikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllali
    kkyehrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikia
    dlgnacwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeg
    hsytkdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvlteky
    kfskdeakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdi
    pgwfeevrdhkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q99B (B:)
    ggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaed
    eikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkye
    hrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgn
    acwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsyt
    kdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfsk
    deakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwf
    eevr