PDB entry 1q8x

View 1q8x on RCSB PDB site
Description: NMR structure of human cofilin
Class: structural protein
Keywords: ADF/cofilin, chemical shift perturbation, NMR, actin cytoskeleton, G-actin binding, STRUCTURAL PROTEIN
Deposited on 2003-08-22, released 2004-07-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cofilin, non-muscle isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: CFL1 OR CFL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q8xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q8xA (A:)
masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv
gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass
kdaikkkltgikhelqancyeevkdrctlaeklggsavislegkpl