PDB entry 1q8x

View 1q8x on RCSB PDB site
Description: NMR structure of human cofilin
Class: structural protein
Keywords: ADF/cofilin, chemical shift perturbation, NMR, actin cytoskeleton, G-actin binding
Deposited on 2003-08-22, released 2004-07-06
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-06, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cofilin, non-muscle isoform
    Species: HOMO SAPIENS
    Gene: CFL1 OR CFL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q8xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q8xA (A:)
    masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv
    gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass
    kdaikkkltgikhelqancyeevkdrctlaeklggsavislegkpl