PDB entry 1q8v

View 1q8v on RCSB PDB site
Description: Pterocarpus angolensis lectin (PAL) in complex with the trimannoside [Man(Alpha1-3)]Man(alpha1-6)Man
Deposited on 2003-08-22, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q8va_
  • Chain 'B':
    Domains in SCOP 1.67: d1q8vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8vA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8vA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q8vB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8vB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a