PDB entry 1q8o

View 1q8o on RCSB PDB site
Description: Pterocartpus angolensis lectin PAL in complex with the dimmanoside Man(alpha1-2)Man
Class: sugar binding protein
Keywords: lectin, carbohydrate, mannose
Deposited on 2003-08-22, released 2004-02-10
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pterocarpus angolensis
    Database cross-references and differences (RAF-indexed):
    • GB CAD19805 (0-End)
      • modified residue (0)
    Domains in SCOP 1.73: d1q8oa_
  • Chain 'B':
    Compound: lectin
    Species: Pterocarpus angolensis
    Database cross-references and differences (RAF-indexed):
    • GB CAD19805 (0-End)
      • modified residue (0)
    Domains in SCOP 1.73: d1q8ob_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8oA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8oA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q8oB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8oB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a