PDB entry 1q8o

View 1q8o on RCSB PDB site
Description: Pterocartpus angolensis lectin PAL in complex with the dimmanoside Man(alpha1-2)Man
Deposited on 2003-08-22, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q8oa_
  • Chain 'B':
    Domains in SCOP 1.67: d1q8ob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8oA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8oA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q8oB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8oB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a