PDB entry 1q8m

View 1q8m on RCSB PDB site
Description: Crystal structure of the human myeloid cell activating receptor TREM-1
Class: immune system receptor
Keywords: V-type Ig-like domain, Immunoglobulin-like, IMMUNE SYSTEM RECEPTOR
Deposited on 2003-08-21, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triggering receptor expressed on myeloid cells 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TREM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP99 (1-118)
      • initiating met (0)
      • cloning artifact (119-120)
    Domains in SCOPe 2.07: d1q8ma1, d1q8ma2
  • Chain 'B':
    Compound: triggering receptor expressed on myeloid cells 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TREM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP99 (1-118)
      • initiating met (0)
      • cloning artifact (119-120)
    Domains in SCOPe 2.07: d1q8mb1, d1q8mb2
  • Chain 'C':
    Compound: triggering receptor expressed on myeloid cells 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TREM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP99 (1-118)
      • initiating met (0)
      • cloning artifact (119-120)
    Domains in SCOPe 2.07: d1q8mc1, d1q8mc2
  • Chain 'D':
    Compound: triggering receptor expressed on myeloid cells 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TREM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP99 (1-118)
      • initiating met (0)
      • cloning artifact (119-120)
    Domains in SCOPe 2.07: d1q8md1, d1q8md2
  • Heterogens: SO4, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8mA (A:)
    melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
    nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8mA (A:)
    melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
    nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q8mB (B:)
    melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
    nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8mB (B:)
    melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
    nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q8mC (C:)
    melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
    nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8mC (C:)
    melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
    nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q8mD (D:)
    melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
    nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8mD (D:)
    melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
    nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
    e