PDB entry 1q8l

View 1q8l on RCSB PDB site
Description: Second Metal Binding Domain of the Menkes ATPase
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2003-08-21, released 2004-01-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting ATPase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7A OR MNK OR MC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04656 (1-83)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d1q8la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q8lA (A:)
    gsmaqagevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisv
    eemkkqieamgfpafvkkqpkylk