PDB entry 1q8j

View 1q8j on RCSB PDB site
Description: Cobalamin-dependent methionine synthase (1-566) from Thermotoga maritima (Cd2+, Hcy, methyltetrahydrofolate complex)
Class: transferase
Keywords: homocysteine, methionine, folate, cobalamin, vitamin b12, TRANSFERASE
Deposited on 2003-08-21, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydrofolate S-homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q8ja1, d1q8ja2
  • Chain 'B':
    Compound: 5-methyltetrahydrofolate S-homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q8jb1, d1q8jb2
  • Heterogens: CD, HCS, C2F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8jA (A:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekkelpraevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8jA (A:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q8jB (B:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekkelpraevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8jB (B:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagyplk
    phdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkrifavsspsklv
    tfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvnfgiesqidvr
    yvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeelemkinllkky
    ggtlivllsfeerkeyfekalkilerhdfsdrvifdpgvlplgaegkpvevlktiefiss
    kgfnttvglsnlspdrsyyntaflvlgiskglssaimnpldetlmktlnatlvilekk