PDB entry 1q8h

View 1q8h on RCSB PDB site
Description: Crystal structure of porcine osteocalcin
Class: metal binding protein
Keywords: helix-turn-helix-turn-helix, Paper-clip, hydroxyapatite crystal surface binding protein, calcium binding protein, bone gla protein
Deposited on 2003-08-21, released 2003-11-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.255
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Osteocalcin
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8HYY9 (Start-48)
      • modified residue (16)
      • modified residue (20)
      • modified residue (23)
    Domains in SCOP 1.73: d1q8ha_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8hA (A:)
    yldhglgapapypdpleprrevcelnpdcdeladhigfqeayrrfygia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8hA (A:)
    pdpleprrevcelnpdcdeladhigfqeayrrfygia