PDB entry 1q8h

View 1q8h on RCSB PDB site
Description: crystal structure of porcine osteocalcin
Deposited on 2003-08-21, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.255
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q8ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1q8hA (A:)
yldhglgapapypdpleprrevcelnpdcdeladhigfqeayrrfygia

    Sequence, based on observed residues (ATOM records): (download) 
    >1q8hA (A:)
pdpleprrevcelnpdcdeladhigfqeayrrfygia