PDB entry 1q8h

View 1q8h on RCSB PDB site
Description: Crystal structure of porcine osteocalcin
Class: metal binding protein
Keywords: helix-turn-helix-turn-helix, Paper-clip, hydroxyapatite crystal surface binding protein, calcium binding protein, bone gla protein, METAL BINDING PROTEIN
Deposited on 2003-08-21, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Osteocalcin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8HYY9 (Start-48)
  Domains in SCOPe 2.08: d1q8ha_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1q8hA (A:)
  yldhglgapapypdpleprrevcelnpdcdeladhigfqeayrrfygia
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1q8hA (A:)
  pdpleprrevcelnpdcdeladhigfqeayrrfygia