PDB entry 1q8c

View 1q8c on RCSB PDB site
Description: A conserved hypothetical protein from Mycoplasma genitalium shows structural homology to NusB proteins
Class: structural genomics,unknown function
Keywords: structural genomics, NusB, hypothetical protein, MG027, GI 3844637, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, STRUCTURAL GENOMICS,UNKNOWN FUNCTION
Deposited on 2003-08-20, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.255
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein MG027
  Species: Mycoplasma genitalium [TaxId:2097]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P47273 (Start-150)
  Domains in SCOPe 2.08: d1q8ca_
• Heterogens: IOD, CL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1q8cA (A:)
  maitvkgltnkltrtqrriavvefifsllfflpkeaeviqadfleydtkerqlnewqkli
  vkafsenifsfqkkieeqqlknqleiqtkynkisgkkidllttavvlcalseqkahntdk
  plliseallimdhysqgaekkqthalldkll
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1q8cA (A:)
  ltrtqrriavvefifsllfflpkeaeviqadfleydtkerqlnewqklivkafsenifsf
  qkkieeqqlknqleiqtkidllttavvlcalseqkahntdkplliseallimdhysqgae
  kkqthalldkll