PDB entry 1q8b

View 1q8b on RCSB PDB site
Description: Structural Genomics, protein YJCS
Deposited on 2003-08-20, released 2004-03-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q8ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8bA (A:)
    mkshkmmgggismhyitaclkiisdkdlneimkefkkleeetnkeegcitfhayplepse
    rkimlweiweneeavkihftkkhtidvqkqeltevewlmksnvnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8bA (A:)
    smhyitaclkiisdkdlneimkefkkleeetnkeegcitfhayplepserkimlweiwen
    eeavkihftkkhtidvqkqeltevewlmksnvn