PDB entry 1q8b

View 1q8b on RCSB PDB site
Description: Structural Genomics, protein YJCS
Class: Structural Genomics, Unknown Function
Keywords: Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Unknown Function
Deposited on 2003-08-20, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yjcS
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YJCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31641
      • modified residue (12)
      • modified residue (31)
      • modified residue (63)
      • modified residue (98)
    Domains in SCOPe 2.08: d1q8ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8bA (A:)
    mkshkmmgggismhyitaclkiisdkdlneimkefkkleeetnkeegcitfhayplepse
    rkimlweiweneeavkihftkkhtidvqkqeltevewlmksnvnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8bA (A:)
    smhyitaclkiisdkdlneimkefkkleeetnkeegcitfhayplepserkimlweiwen
    eeavkihftkkhtidvqkqeltevewlmksnvn