PDB entry 1q85

View 1q85 on RCSB PDB site
Description: Cobalamin-dependent methionine synthase (1-566) from Thermotoga maritima (Cd2+ complex, Se-Met)
Class: transferase
Keywords: homocysteine, methionine, folate, cobalamin, vitamin b12, TRANSFERASE
Deposited on 2003-08-20, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydrofolate S-homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYA5 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (70)
      • modified residue (134)
      • modified residue (173)
      • modified residue (333)
      • modified residue (421)
      • modified residue (438)
      • modified residue (536)
      • modified residue (544)
    Domains in SCOPe 2.07: d1q85a1, d1q85a2
  • Chain 'B':
    Compound: 5-methyltetrahydrofolate S-homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYA5 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (70)
      • modified residue (134)
      • modified residue (173)
      • modified residue (333)
      • modified residue (421)
      • modified residue (438)
      • modified residue (536)
      • modified residue (544)
    Domains in SCOPe 2.07: d1q85b1, d1q85b2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q85A (A:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekkelpraevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q85A (A:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q85B (B:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekkelpraevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q85B (B:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagtvyp
    lkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkrifavsspsk
    lvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvnfgiesqid
    vryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeelemkinllk
    kyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplgaegkpvev
    lktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpldetlmktl
    natlvilekk