PDB entry 1q80

View 1q80 on RCSB PDB site
Description: Solution structure and dynamics of Nereis sarcoplasmic calcium binding protein
Class: metal binding protein
Keywords: all-alpha, METAL BINDING PROTEIN
Deposited on 2003-08-20, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sarcoplasmic calcium-binding protein
  Species: Neanthes diversicolor [TaxId:6352]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04571 (0-173)
  Domains in SCOPe 2.07: d1q80a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q80A (A:)
  sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
  ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
  gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv