PDB entry 1q80

View 1q80 on RCSB PDB site
Description: Solution structure and dynamics of Nereis sarcoplasmic calcium binding protein
Class: metal binding protein
Keywords: all-alpha, METAL BINDING PROTEIN
Deposited on 2003-08-20, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sarcoplasmic calcium-binding protein
    Species: Neanthes diversicolor [TaxId:6352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q80a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q80A (A:)
    sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
    ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
    gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv