PDB entry 1q7s

View 1q7s on RCSB PDB site
Description: Crystal structure of bit1
Class: apoptosis
Keywords: apoptosis
Deposited on 2003-08-19, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bit1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q7sa_
  • Chain 'B':
    Compound: bit1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q7sb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q7sA (A:)
    geykmilvvrndlkmgkgkvaaqcshaavsaykqiqrrnpemlkqweycgqpkvvvkapd
    eetliallahakmlgltvsliqdagrtqiapgsqtvlgigpgpadlidkvtghlkly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q7sB (B:)
    geykmilvvrndlkmgkgkvaaqcshaavsaykqiqrrnpemlkqweycgqpkvvvkapd
    eetliallahakmlgltvsliqdagrtqiapgsqtvlgigpgpadlidkvtghlkly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7sB (B:)
    eykmilvvrndlkmgkgkvaaqcshaavsaykqiqrrnpemlkqweycgqpkvvvkapde
    etliallahakmlgltvsliqdatqiapgsqtvlgigpgpadlidkvtghlkly