PDB entry 1q7m

View 1q7m on RCSB PDB site
Description: Cobalamin-dependent methionine synthase (MetH) from Thermotoga maritima (Oxidized, Monoclinic)
Class: transferase
Keywords: homocysteine, methionine, folate, cobalamin, vitamin b12, TRANSFERASE
Deposited on 2003-08-19, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydrofolate S-homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q7ma1, d1q7ma2
  • Chain 'B':
    Compound: 5-methyltetrahydrofolate S-homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q7mb1, d1q7mb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q7mA (A:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekkelpraevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7mA (A:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q7mB (B:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekkelpraevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7mB (B:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    gktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkrifa
    vsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvnfg
    iesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeelem
    kinllkkyggtlivllmgsfeerkeyfekalkilerhdfsdrvifdpgvlplgaegkpve
    vlktiefisskgfnttvglsnlspdrsyyntaflvlgiskglssaimnpldetlmktlna
    tlvilekk