PDB entry 1q7l

View 1q7l on RCSB PDB site
Description: Zn-binding domain of the T347G mutant of human aminoacylase-I
Class: hydrolase
Keywords: aminoacylase-1, catalysis, enzyme dimerization, site-directed mutagenesis, structure comparison, zinc, HYDROLASE
Deposited on 2003-08-19, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.133
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoacylase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q7l.1
  • Chain 'B':
    Compound: Aminoacylase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03154 (0-87)
      • engineered (26)
    Domains in SCOPe 2.07: d1q7l.1
  • Chain 'C':
    Compound: Aminoacylase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q7l.2
  • Chain 'D':
    Compound: Aminoacylase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03154 (0-End)
      • engineered (26)
    Domains in SCOPe 2.07: d1q7l.2
  • Heterogens: ZN, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q7lA (A:)
    mtskgpeeehpsvtlfrqylrirtvqpkpdygaavaffeetarqlglgcqkvevapgyvv
    tvltwpgtnptlssillnshtdvvpvfkehwshdpfeafkdsegyiyargaqdmkcvsiq
    yleavrrlkveghrfprtihmtfvpdeevgghqgmelfvqrpefhalragfaldegianp
    tdaftvfyserspwwvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7lA (A:)
    eeehpsvtlfrqylrirtvqpkpdygaavaffeetarqlglgcqkvevapgyvvtvltwp
    gtnptlssillnshtdvvpvfkehwshdpfeafkdsegyiyargaqdmkcvsiqyleavr
    rlkveghrfprtihmtfvpdeevgghqgmelfvqrpefhalragfaldegianptdaftv
    fyserspwwvrv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q7lB (B:)
    npwwaafsrvckdmnltlepeimpaagdnryiravgvpalgfspmnrtpvllhdhderlh
    eavflrgvdiytrllpalasvpalpsds
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q7lC (C:)
    mtskgpeeehpsvtlfrqylrirtvqpkpdygaavaffeetarqlglgcqkvevapgyvv
    tvltwpgtnptlssillnshtdvvpvfkehwshdpfeafkdsegyiyargaqdmkcvsiq
    yleavrrlkveghrfprtihmtfvpdeevgghqgmelfvqrpefhalragfaldegianp
    tdaftvfyserspwwvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7lC (C:)
    eehpsvtlfrqylrirtvqpkpdygaavaffeetarqlglgcqkvevapgyvvtvltwpg
    tnptlssillnshtdvvpvfkehwshdpfeafkdsegyiyargaqdmkcvsiqyleavrr
    lkveghrfprtihmtfvpdeevgghqgmelfvqrpefhalragfaldegianptdaftvf
    yserspwwvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q7lD (D:)
    npwwaafsrvckdmnltlepeimpaagdnryiravgvpalgfspmnrtpvllhdhderlh
    eavflrgvdiytrllpalasvpalpsds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7lD (D:)
    npwwaafsrvckdmnltlepeimpaagdnryiravgvpalgfspmnrtpvllhdhderlh
    eavflrgvdiytrllpalasvpalp