PDB entry 1q7h

View 1q7h on RCSB PDB site
Description: Structure of a Conserved PUA Domain Protein from Thermoplasma acidophilum
Class: Structural genomics, unknown function
Keywords: Thermoplasma acidophilum, structural genomics, MCSG, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics
Deposited on 2003-08-18, released 2004-01-20
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.169
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Thermoplasma acidophilum
    Gene: Ta1423
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HIB8 (Start-152)
      • conflict (17)
      • modified residue (18)
      • conflict (19)
      • modified residue (48)
      • modified residue (96)
      • modified residue (105)
      • modified residue (120)
      • modified residue (123)
      • modified residue (129)
    Domains in SCOP 1.75: d1q7ha1, d1q7ha2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q7hA (A:)
    mtskhfiskkeakriweqmsrygiditgeslevaaqksasayyiggkpmvfqagdlipsv
    yllnyrnpsrnivtvdegaephilngsdlfapgivsmddsirkgdmifvksskgyfiavg
    maemdagevmatkrgkaariihfpgdelirafp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7hA (A:)
    skhfiskkeakriweqmsrygiditgeslevaaqksasayyiggkpmvfqagdlipsvyl
    lnyrnpsrnivtvdegaephilngsdlfapgivsmddsirkgdmifvksskgyfiavgma
    emdagevmatkrgkaariihfpgdelirafp