PDB entry 1q7h

View 1q7h on RCSB PDB site
Description: structure of a conserved pua domain protein from thermoplasma acidophilum
Deposited on 2003-08-18, released 2004-01-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.169
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q7hA (A:)
    mtskhfiskkeakriweqmsrygiditgeslevaaqksasayyiggkpmvfqagdlipsv
    yllnyrnpsrnivtvdegaephilngsdlfapgivsmddsirkgdmifvksskgyfiavg
    maemdagevmatkrgkaariihfpgdelirafp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7hA (A:)
    skhfiskkeakriweqmsrygiditgeslevaaqksasayyiggkpmvfqagdlipsvyl
    lnyrnpsrnivtvdegaephilngsdlfapgivsmddsirkgdmifvksskgyfiavgma
    emdagevmatkrgkaariihfpgdelirafp