PDB entry 1q7f

View 1q7f on RCSB PDB site
Description: Brain Tumor NHL domain
Class: translation
Keywords: brat, NHL domain, NHL repeat, beta-propeller, TRANSLATION
Deposited on 2003-08-18, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: brain tumor CG10719-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: brain tumor
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MQJ9 (Start-285)
      • conflict (11)
    Domains in SCOPe 2.07: d1q7fa_
  • Chain 'B':
    Compound: brain tumor CG10719-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: brain tumor
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MQJ9 (4-285)
      • conflict (11)
    Domains in SCOPe 2.07: d1q7fb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q7fA (A:)
    gthmksqikrqrmiyhckfgefgvmegqftepsgvavnaqndiivadtnnhriqifdkeg
    rfkfqfgecgkrdsqllypnrvavvrnsgdiivterspthqiqiynqygqfvrkfgatil
    qhprgvtvdnkgriivveckvmrviifdqngnvlhkfgcskhlefpngvvvndkqeifis
    dnrahcvkvfnyegqylrqiggegitnypigvginsngeiliadnhnnfnltiftqdgql
    isaleskvkhaqcfdvalmddgsvvlaskdyrlyiyryvqlapvgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7fA (A:)
    ikrqrmiyhckfgefgvmegqftepsgvavnaqndiivadtnnhriqifdkegrfkfqfg
    ecgkrdsqllypnrvavvrnsgdiivterspthqiqiynqygqfvrkfgatilqhprgvt
    vdnkgriivveckvmrviifdqngnvlhkfgcskhlefpngvvvndkqeifisdnrahcv
    kvfnyegqylrqiggegitnypigvginsngeiliadnhnnfnltiftqdgqlisalesk
    vkhaqcfdvalmddgsvvlaskdyrlyiyryvqlapvgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q7fB (B:)
    gthmksqikrqrmiyhckfgefgvmegqftepsgvavnaqndiivadtnnhriqifdkeg
    rfkfqfgecgkrdsqllypnrvavvrnsgdiivterspthqiqiynqygqfvrkfgatil
    qhprgvtvdnkgriivveckvmrviifdqngnvlhkfgcskhlefpngvvvndkqeifis
    dnrahcvkvfnyegqylrqiggegitnypigvginsngeiliadnhnnfnltiftqdgql
    isaleskvkhaqcfdvalmddgsvvlaskdyrlyiyryvqlapvgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7fB (B:)
    ksqikrqrmiyhckfgefgvmegqftepsgvavnaqndiivadtnnhriqifdkegrfkf
    qfgecgkrdsqllypnrvavvrnsgdiivterspthqiqiynqygqfvrkfgatilqhpr
    gvtvdnkgriivveckvmrviifdqngnvlhkfgcskhlefpngvvvndkqeifisdnra
    hcvkvfnyegqylrqiggegitnypigvginsngeiliadnhnnfnltiftqdgqlisal
    eskvkhaqcfdvalmddgsvvlaskdyrlyiyryvqlapvgm